RVG29-Cys

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M2-9301	50mg	745.00	- +	+ Add to cart
R-M2-9301	100mg	1269.00	- +	+ Add to cart

Product description

RVG29-Cys is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling.

Appearance	Freeze-dried powder
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Molecular formula	C144H222N44O44S3
Sequence	YTIWMPENPRPGTPCDIFTNSRGKRASNGC/Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys
Cas	1186105-01-0
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1-2 year

Document

msds of RVG29-Cys